PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676729582
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family LFY
Protein Properties Length: 446aa    MW: 49418.5 Da    PI: 6.8359
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676729582genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY352.86.1e-10812891285
    FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrld 100
                mdpe f++ lf+w+p  a+++p+  + + +++  +p++ ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+d+m+sls+ifr++
  676729582   1 MDPEGFTSGLFRWNPTRAMVQPQPPVPPPQQQ--SPATPQSAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEDMMNSLSHIFRWE 98 
                9*************877776666566555543..333456777788888*************************************************** PP

    FLO_LFY 101 llvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkq 193
                llvGeryGikaavraer+rl+e  ee++++rr+l+      + +++aldalsqeglseepvq++ ++ ++g  +    +   a +   ++ kk++ + ++
  676729582  99 LLVGERYGIKAAVRAERKRLQEeeEEESSRRRHLIlsaagDSGTHHALDALSQEGLSEEPVQQQDQTDAAGIIRGDGGGYWEAGQ---SKMKKQQ-Q-RR 193
                ********************99544556788887778844344556***************997776666555533333333331...2222222.2.23 PP

    FLO_LFY 194 krkkkkelkseededeeeeededeeg.....sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqv 285
                ++k    ++ e+d+d +e ed+d+++     +g  g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq+iak+rGekcPtk+   v
  676729582 194 RKK-PMVTSVETDDDGNEGEDDDGMDngnggGGGLGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAKDRGEKCPTKIQASV 289
                333.333334444444444444444412222444456*******************************************************98766 PP

2FLO_LFY243.78.4e-75316423279386
    FLO_LFY 279 tkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLC 378
                t vtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasna+rrafkergenvG+wrqacykplv+ia r+gwdidavfnahprLsiWYvPtkLrqLC
  676729582 316 THVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNAVRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLC 415
                89************************************************************************************************** PP

    FLO_LFY 379 hlerskas 386
                hler++a+
  676729582 416 HLERNNAV 423
                ****9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016987.2E-1951422IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QPQPPVPPPQ QQSPATPQSA AFGMRLGGLE GLFGAYGIRF  60
YTAAKIAELG FTASTLVGMK DEELEDMMNS LSHIFRWELL VGERYGIKAA VRAERKRLQE  120
EEEEESSRRR HLILSAAGDS GTHHALDALS QEGLSEEPVQ QQDQTDAAGI IRGDGGGYWE  180
AGQSKMKKQQ QRRRKKPMVT SVETDDDGNE GEDDDGMDNG NGGGGGLGME RQREHPFIVT  240
EPGEVARGKK NGLDYLFHLY EQCREFLLQV QTIAKDRGEK CPTKIQASVQ WVIKDLFSSS  300
DDSTESMSSV PLLVQTHVTN QVFRYAKKSG ASYINKPKMR HYVHCYALHC LDEEASNAVR  360
RAFKERGENV GSWRQACYKP LVNIACRHGW DIDAVFNAHP RLSIWYVPTK LRQLCHLERN  420
NAVAAAAALV GGISCAGSSA SGRFGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1222274461187PROTEIN LEAFY
2vy2_A1e-1222274461187PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6159380.0HQ615938.1 Brassica rapa LEAFYb (LFYb) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200993.10.0protein LEAFY
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLQ6XPU70.0Q6XPU7_LEACR; LEAFY-like protein
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)